glycoengineering skill (K-Dense scientific-agent-skills)
- Install
- SKILL.md (verbatim)
- Overview
- When to Use This Skill
- N-Glycosylation Sequon Analysis
- Scanning for N-Glycosylation Sites
- Mutating N-Glycosylation Sites
- O-Glycosylation Analysis
- Heuristic O-Glycosylation Hotspot Prediction
- External Glycoengineering Tools
- 1. NetOGlyc 4.0 (O-glycosylation prediction)
- 2. GlycoShield-MD (Glycan Shielding Analysis)
- 3. GlycoWorkbench (Glycan Structure Drawing/Analysis)
- 4. GlyConnect (Glycan-Protein Database)
- 5. UniCarbKB (Glycan Structure Database)
- Key Glycoengineering Strategies
- For Therapeutic Antibodies
- Common Mutations Used
- Glycan Notation
- IUPAC Condensed Notation (Monosaccharide abbreviations)
- Complex N-Glycan Structure
- Best Practices
- Additional Resources
- Other files in this skill
- references/glycandatabases.md (verbatim)
- Primary Databases
- GlyTouCan
- GlyConnect
- UniCarbKB
- KEGG Glycan
- CAZy (Carbohydrate-Active Enzymes)
- Prediction Servers
- NetNGlyc 1.0
- NetOGlyc 4.0
- GlycoMine (Machine Learning)
- SymLink (Glycosylation site & sequon predictor)
- Mass Spectrometry Glycoproteomics Tools
- Byonic (Protein Metrics)
- Mascot Glycan Analysis
- GlycoWorkbench
- Skyline
- Glycan Nomenclature Systems
- Oxford Notation (For N-glycans)
- Symbol Nomenclature for Glycans (SNFG)
- Therapeutic Glycoproteins and Key Glycosylation Sites
- Batch Analysis Example
What it does. Analyze and engineer protein glycosylation. Scan sequences for N-glycosylation sequons (N-X-S/T), predict O-glycosylation hotspots, and access curated glycoengineering tools (NetOGlyc, GlycoShield, GlycoWorkbench). For glycoprotein engineering, therapeutic antibody optimization, and vaccine design. Part of K-Dense-AI/scientific-agent-skills (AI Scientist skills) (K-Dense-AI/scientific-agent-skills).
| Upstream | K-Dense-AI/scientific-agent-skills |
| Skill file | skills/glycoengineering/SKILL.md |
| License | MIT |
| Author | K-Dense Inc. |
| Fetched | 2026-09-10 |
Install
npx skills add K-Dense-AI/scientific-agent-skills --skill glycoengineering, or copy the skill folder into~/.claude/skills/glycoengineering/.- Raw file:
curl -sL https://raw.githubusercontent.com/K-Dense-AI/scientific-agent-skills/HEAD/skills/glycoengineering/SKILL.md
SKILL.md (verbatim)
name: glycoengineering
description: Analyze and engineer protein glycosylation. Scan sequences for N-glycosylation sequons (N-X-S/T), predict O-glycosylation hotspots, and access curated glycoengineering tools (NetOGlyc, GlycoShield, GlycoWorkbench). For glycoprotein engineering, therapeutic antibody optimization, and vaccine design.
license: Unknown
metadata:
version: "1.1"
skill-author: Kuan-lin Huang
Glycoengineering
Overview
Glycosylation is the most common and complex post-translational modification (PTM) of proteins, affecting over 50% of all human proteins. Glycans regulate protein folding, stability, immune recognition, receptor interactions, and pharmacokinetics of therapeutic proteins. Glycoengineering involves rational modification of glycosylation patterns for improved therapeutic efficacy, stability, or immune evasion.
Two major glycosylation types:
- N-glycosylation: Attached to asparagine (N) in the sequon N-X-[S/T] where X ≠ Proline; occurs in the ER/Golgi
- O-glycosylation: Attached to serine (S) or threonine (T); no strict consensus motif; primarily GalNAc initiation
When to Use This Skill
Use this skill when:
- Antibody engineering: Optimize Fc glycosylation for enhanced ADCC, CDC, or reduced immunogenicity
- Therapeutic protein design: Identify glycosylation sites that affect half-life, stability, or immunogenicity
- Vaccine antigen design: Engineer glycan shields to focus immune responses on conserved epitopes
- Biosimilar characterization: Compare glycan patterns between reference and biosimilar
- Drug target analysis: Does glycosylation affect target engagement for a receptor?
- Protein stability: N-glycans often stabilize proteins; identify sites for stabilizing mutations
N-Glycosylation Sequon Analysis
Scanning for N-Glycosylation Sites
N-glycosylation occurs at the sequon N-X-[S/T] where X ≠ Proline.
import re
from typing import List, Tuple
def find_n_glycosylation_sequons(sequence: str) -> List[dict]:
"""
Scan a protein sequence for canonical N-linked glycosylation sequons.
Motif: N-X-[S/T], where X ≠ Proline.
Args:
sequence: Single-letter amino acid sequence
Returns:
List of dicts with position (1-based), motif, and context
"""
seq = sequence.upper()
results = []
i = 0
while i <= len(seq) - 3:
triplet = seq[i:i+3]
if triplet[0] == 'N' and triplet[1] != 'P' and triplet[2] in {'S', 'T'}:
context = seq[max(0, i-3):i+6] # ±3 residue context
results.append({
'position': i + 1, # 1-based
'motif': triplet,
'context': context,
'sequon_type': 'NXS' if triplet[2] == 'S' else 'NXT'
})
i += 3
else:
i += 1
return results
def summarize_glycosylation_sites(sequence: str, protein_name: str = "") -> str:
"""Generate a research log summary of N-glycosylation sites."""
sequons = find_n_glycosylation_sequons(sequence)
lines = [f"# N-Glycosylation Sequon Analysis: {protein_name or 'Protein'}"]
lines.append(f"Sequence length: {len(sequence)}")
lines.append(f"Total N-glycosylation sequons: {len(sequons)}")
if sequons:
lines.append(f"\nN-X-S sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXS')}")
lines.append(f"N-X-T sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXT')}")
lines.append(f"\nSite details:")
for s in sequons:
lines.append(f" Position {s['position']}: {s['motif']} (context: ...{s['context']}...)")
else:
lines.append("No canonical N-glycosylation sequons detected.")
return "\n".join(lines)
# Example: IgG1 Fc region
fc_sequence = "APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK"
print(summarize_glycosylation_sites(fc_sequence, "IgG1 Fc"))
Mutating N-Glycosylation Sites
def eliminate_glycosite(sequence: str, position: int, replacement: str = "Q") -> str:
"""
Eliminate an N-glycosylation site by substituting Asn → Gln (conservative).
Args:
sequence: Protein sequence
position: 1-based position of the Asn to mutate
replacement: Amino acid to substitute (default Q = Gln; similar size, not glycosylated)
Returns:
Mutated sequence
"""
seq = list(sequence.upper())
idx = position - 1
assert seq[idx] == 'N', f"Position {position} is '{seq[idx]}', not 'N'"
seq[idx] = replacement.upper()
return ''.join(seq)
def add_glycosite(sequence: str, position: int, flanking_context: str = "S") -> str:
"""
Introduce an N-glycosylation site by mutating a residue to Asn,
and ensuring X ≠ Pro and +2 = S/T.
Args:
position: 1-based position to introduce Asn
flanking_context: 'S' or 'T' at position+2 (if modification needed)
"""
seq = list(sequence.upper())
idx = position - 1
# Mutate to Asn
seq[idx] = 'N'
# Ensure X+1 != Pro (mutate to Ala if needed)
if idx + 1 < len(seq) and seq[idx + 1] == 'P':
seq[idx + 1] = 'A'
# Ensure X+2 = S or T
if idx + 2 < len(seq) and seq[idx + 2] not in ('S', 'T'):
seq[idx + 2] = flanking_context
return ''.join(seq)
O-Glycosylation Analysis
Heuristic O-Glycosylation Hotspot Prediction
def predict_o_glycosylation_hotspots(
sequence: str,
window: int = 7,
min_st_fraction: float = 0.4,
disallow_proline_next: bool = True
) -> List[dict]:
"""
Heuristic O-glycosylation hotspot scoring based on local S/T density.
Not a substitute for NetOGlyc; use as fast baseline.
Rules:
- O-GalNAc glycosylation clusters on Ser/Thr-rich segments
- Flag Ser/Thr residues in windows enriched for S/T
- Avoid S/T immediately followed by Pro (TP/SP motifs inhibit GalNAc-T)
Args:
window: Odd window size for local S/T density
min_st_fraction: Minimum fraction of S/T in window to flag site
"""
if window % 2 == 0:
window = 7
seq = sequence.upper()
half = window // 2
candidates = []
for i, aa in enumerate(seq):
if aa not in ('S', 'T'):
continue
if disallow_proline_next and i + 1 < len(seq) and seq[i+1] == 'P':
continue
start = max(0, i - half)
end = min(len(seq), i + half + 1)
segment = seq[start:end]
st_count = sum(1 for c in segment if c in ('S', 'T'))
frac = st_count / len(segment)
if frac >= min_st_fraction:
candidates.append({
'position': i + 1,
'residue': aa,
'st_fraction': round(frac, 3),
'window': f"{start+1}-{end}",
'segment': segment
})
return candidates
External Glycoengineering Tools
1. NetOGlyc 4.0 (O-glycosylation prediction)
Web service for high-accuracy O-GalNAc site prediction:
- URL: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/
- Input: FASTA protein sequence
- Output: Per-residue O-glycosylation probability scores
- Method: Neural network trained on experimentally verified O-GalNAc sites
import requests
def submit_netoglycv4(fasta_sequence: str) -> str:
"""
Submit sequence to NetOGlyc 4.0 web service.
Returns the job URL for result retrieval.
Note: This uses the DTU Health Tech web service. Results take ~1-5 min.
"""
url = "https://services.healthtech.dtu.dk/cgi-bin/webface2.cgi"
# NetOGlyc submission (parameters may vary with web service version)
# Recommend using the web interface directly for most use cases
print("Submit sequence at: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/")
return url
# Also: NetNGlyc for N-glycosylation prediction
# URL: https://services.healthtech.dtu.dk/services/NetNGlyc-1.0/
2. GlycoShield-MD (Glycan Shielding Analysis)
GlycoShield-MD analyzes how glycans shield protein surfaces during MD simulations:
- URL: https://gitlab.mpcdf.mpg.de/dioscuri-biophysics/glycoshield-md/
- Use: Map glycan shielding on protein surface over MD trajectory
- Output: Per-residue shielding fraction, visualization
# Installation
uv pip install glycoshield
# Basic usage: analyze glycan shielding from glycosylated protein MD trajectory
glycoshield \
--topology glycoprotein.pdb \
--trajectory glycoprotein.xtc \
--glycan_resnames BGLCNA FUC \
--output shielding_analysis/
3. GlycoWorkbench (Glycan Structure Drawing/Analysis)
- URL: https://www.eurocarbdb.org/project/glycoworkbench
- Use: Draw glycan structures, calculate masses, annotate MS spectra
- Format: GlycoCT, IUPAC condensed glycan notation
4. GlyConnect (Glycan-Protein Database)
- URL: https://glyconnect.expasy.org/
- Use: Find experimentally verified glycoproteins and glycosylation sites
- Query: By protein (UniProt ID), glycan structure, or tissue
import requests
def query_glyconnect(uniprot_id: str) -> dict:
"""Query GlyConnect for glycosylation data for a protein."""
url = f"https://glyconnect.expasy.org/api/proteins/uniprot/{uniprot_id}"
response = requests.get(url, headers={"Accept": "application/json"})
if response.status_code == 200:
return response.json()
return {}
# Example: query EGFR glycosylation
egfr_glyco = query_glyconnect("P00533")
5. UniCarbKB (Glycan Structure Database)
- URL: https://unicarbkb.org/
- Use: Browse glycan structures, search by mass or composition
- Format: GlycoCT or IUPAC notation
Key Glycoengineering Strategies
For Therapeutic Antibodies
| Goal | Strategy | Notes |
|---|---|---|
| Enhance ADCC | Defucosylation at Fc Asn297 | Afucosylated IgG1 has ~50× better FcγRIIIa binding |
| Reduce immunogenicity | Remove non-human glycans | Eliminate α-Gal, NGNA epitopes |
| Improve PK half-life | Sialylation | Sialylated glycans extend half-life |
| Reduce inflammation | Hypersialylation | IVIG anti-inflammatory mechanism |
| Create glycan shield | Add N-glycosites to surface | Masks vulnerable epitopes (vaccine design) |
Common Mutations Used
| Mutation | Effect |
|---|---|
| N297A/Q (IgG1) | Removes Fc glycosylation (aglycosyl) |
| N297D (IgG1) | Removes Fc glycosylation |
| S298A/E333A/K334A | Increases FcγRIIIa binding |
| F243L (IgG1) | Increases defucosylation |
| T299A | Removes Fc glycosylation |
Glycan Notation
IUPAC Condensed Notation (Monosaccharide abbreviations)
| Symbol | Full Name | Type |
|---|---|---|
| Glc | Glucose | Hexose |
| GlcNAc | N-Acetylglucosamine | HexNAc |
| Man | Mannose | Hexose |
| Gal | Galactose | Hexose |
| Fuc | Fucose | Deoxyhexose |
| Neu5Ac | N-Acetylneuraminic acid (Sialic acid) | Sialic acid |
| GalNAc | N-Acetylgalactosamine | HexNAc |
Complex N-Glycan Structure
Typical complex biantennary N-glycan:
Neu5Ac-Gal-GlcNAc-Man\
Man-GlcNAc-GlcNAc-[Asn]
Neu5Ac-Gal-GlcNAc-Man/
(±Core Fuc at innermost GlcNAc)
Best Practices
- Start with NetNGlyc/NetOGlyc for computational prediction before experimental validation
- Verify with mass spectrometry: Glycoproteomics (Byonic, Mascot) for site-specific glycan profiling
- Consider site context: Not all predicted sequons are actually glycosylated (accessibility, cell type, protein conformation)
- For antibodies: Fc N297 glycan is critical — always characterize this site first
- Use GlyConnect to check if your protein of interest has experimentally verified glycosylation data
Additional Resources
- GlyTouCan (glycan structure repository): https://glytoucan.org/
- GlyConnect: https://glyconnect.expasy.org/
- CFG Functional Glycomics: http://www.functionalglycomics.org/
- DTU Health Tech servers (NetNGlyc, NetOGlyc): https://services.healthtech.dtu.dk/
- GlycoWorkbench: https://glycoworkbench.software.informer.com/
- Review: Apweiler R et al. (1999) Biochim Biophys Acta. PMID: 10564035
- Therapeutic glycoengineering review: Jefferis R (2009) Nature Reviews Drug Discovery. PMID: 19448661
Other files in this skill
references/glycan_databases.md (verbatim)
Glycan Databases and Resources Reference
Primary Databases
GlyTouCan
- URL: https://glytoucan.org/
- Content: Unique accession numbers (GTC IDs) for glycan structures
- Use: Standardized glycan identification across databases
- Format: GlycoCT, WURCS, IUPAC
import requests
def lookup_glytoucan(glytoucan_id: str) -> dict:
"""Fetch glycan details from GlyTouCan."""
url = f"https://api.glytoucan.org/glycan/{glytoucan_id}"
response = requests.get(url, headers={"Accept": "application/json"})
return response.json() if response.ok else {}
GlyConnect
- URL: https://glyconnect.expasy.org/
- Content: Protein glycosylation database with site-specific glycan profiles
- Integration: Links UniProt proteins to experimentally verified glycosylation
- Use: Look up known glycosylation for your target protein
import requests
def get_glycoprotein_info(uniprot_id: str) -> dict:
"""Get glycosylation data for a protein from GlyConnect."""
base_url = "https://glyconnect.expasy.org/api"
response = requests.get(f"{base_url}/proteins/uniprot/{uniprot_id}")
return response.json() if response.ok else {}
def get_glycan_compositions(glyconnect_protein_id: int) -> list:
"""Get all glycan compositions for a GlyConnect protein entry."""
base_url = "https://glyconnect.expasy.org/api"
response = requests.get(f"{base_url}/compositions/protein/{glyconnect_protein_id}")
return response.json().get("data", []) if response.ok else []
UniCarbKB
- URL: https://unicarbkb.org/
- Content: Curated glycan structures with biological context
- Features: Tissue/cell-type specific glycan data, mass spectrometry data
KEGG Glycan
- URL: https://www.genome.jp/kegg/glycan/
- Content: Glycan structures in KEGG format, biosynthesis pathways
- Integration: Links to KEGG PATHWAY maps for glycan biosynthesis
CAZy (Carbohydrate-Active Enzymes)
- URL: http://www.cazy.org/
- Content: Enzymes that build, break, and modify glycans
- Use: Identify enzymes for glycoengineering applications
Prediction Servers
NetNGlyc 1.0
- URL: https://services.healthtech.dtu.dk/services/NetNGlyc-1.0/
- Method: Neural network for N-glycosylation site prediction
- Input: Protein FASTA sequence
- Output: Per-asparagine probability score; threshold ~0.5
NetOGlyc 4.0
- URL: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/
- Method: Neural network for O-GalNAc glycosylation prediction
- Input: Protein FASTA sequence
- Output: Per-serine/threonine probability; threshold ~0.5
GlycoMine (Machine Learning)
- Machine learning predictor for N-, O- and C-glycosylation
- Multiple glycan types: N-GlcNAc, O-GalNAc, O-GlcNAc, O-Man, O-Fuc, O-Glc, C-Man
SymLink (Glycosylation site & sequon predictor)
- Species-specific N-glycosylation prediction
- More specific than simple sequon scanning
Mass Spectrometry Glycoproteomics Tools
Byonic (Protein Metrics)
- De novo glycopeptide identification from MS2 spectra
- Comprehensive glycan database
- Site-specific glycoform assignment
Mascot Glycan Analysis
- Glycan-specific search parameters
- Common for bottom-up glycoproteomics
GlycoWorkbench
- URL: https://www.eurocarbdb.org/project/glycoworkbench
- Glycan structure drawing and mass calculation
- Annotation of MS/MS spectra with glycan fragment ions
Skyline
- Targeted quantification of glycopeptides
- Integrates with glycan database
Glycan Nomenclature Systems
Oxford Notation (For N-glycans)
Codes complex N-glycans as text strings:
G0F = Core-fucosylated, biantennary, no galactose
G1F = Core-fucosylated, one galactose
G2F = Core-fucosylated, two galactoses
G2FS1 = Core-fucosylated, two galactoses, one sialic acid
G2FS2 = Core-fucosylated, two galactoses, two sialic acids
M5 = High mannose 5 (Man5GlcNAc2)
M9 = High mannose 9 (Man9GlcNAc2)
Symbol Nomenclature for Glycans (SNFG)
Standard colored symbols for publications:
- Blue circle = Glucose
- Green circle = Mannose
- Yellow circle = Galactose
- Blue square = N-Acetylglucosamine
- Yellow square = N-Acetylgalactosamine
- Purple diamond = N-Acetylneuraminic acid (sialic acid)
- Red triangle = Fucose
Therapeutic Glycoproteins and Key Glycosylation Sites
| Therapeutic | Target | Key Glycosylation | Function |
|---|---|---|---|
| IgG1 antibody | Various | N297 (Fc) | ADCC/CDC effector function |
| Erythropoietin | EPOR | N24, N38, N83, O-glycans | Pharmacokinetics |
| Etanercept | TNF | N420 (IgG1 Fc) | Half-life |
| tPA (alteplase) | Fibrin | N117, N184, N448 | Fibrin binding |
| Factor VIII | VWF | 25 N-glycosites | Clearance |
Batch Analysis Example
from glycoengineering_tools import find_n_glycosylation_sequons, predict_o_glycosylation_hotspots
import pandas as pd
def analyze_glycosylation_landscape(sequences_dict: dict) -> pd.DataFrame:
"""
Batch analysis of glycosylation for multiple proteins.
Args:
sequences_dict: {protein_name: sequence}
Returns:
DataFrame with glycosylation summary per protein
"""
results = []
for name, seq in sequences_dict.items():
n_sites = find_n_glycosylation_sequons(seq)
o_sites = predict_o_glycosylation_hotspots(seq)
results.append({
'protein': name,
'length': len(seq),
'n_glycosites': len(n_sites),
'o_glyco_hotspots': len(o_sites),
'n_glyco_density': len(n_sites) / len(seq) * 100,
'n_glyco_positions': [s['position'] for s in n_sites]
})
return pd.DataFrame(results)
Back to K-Dense-AI/scientific-agent-skills (AI Scientist skills) or Agent skills.