tamarind skill (K-Dense scientific-agent-skills)
- Install
- SKILL.md (verbatim)
- Canonical sources — fetch these, don't rely on a stale copy
- When to use this skill
- Access and authentication
- Two ways to call Tamarind
- MCP server (best for AI agents)
- REST API (universal)
- Core workflow
- Discovering tools
- Choosing the right tool
- Job settings, schemas, and validation
- File inputs (PDB, CIF, SDF, …)
- Chaining jobs into pipelines
- Batch submission
- Job status lifecycle
- Error handling
- Reference files
- Other files in this skill
- references/apireference.md (verbatim)
- Endpoints
- Request shapes
- GET /tools
- POST /submit-job
- POST /submit-batch
- GET /jobs
- POST /result (two-step download)
- Status codes
- Field-handling rules (important)
- Authentication and secrets
- references/examples.md (verbatim)
- Self-check (run this first to confirm the skill works for you)
- Validated input payloads
- AlphaFold — monomer
- AlphaFold — multimer (colon-separated chains)
- Boltz-2 — sequence mode
- DiffDock — protein + SMILES ligand
- Autodock Vina — protein + SMILES ligand (classical docking into a pocket)
- ProteinMPNN — design residues on a backbone
- Batch (same tool, many jobs)
- What fails (and the exact error) — confirmed live
- Output shapes (describe, don't expect exact values)
- references/toolcatalog.md (verbatim)
- How to discover
- Modalities and functions (the two filter axes)
- Representative tool families
- Reading a tool schema
What it does. Access a collection of open-source molecular design and structural biology tools on the Tamarind Bio platform, via its REST API or MCP server — no local GPUs required. Tamarind bundles popular open-source models for structure prediction (AlphaFold, Boltz, Chai, ESMFold), protein, binder, and de novo design (RFdiffusion, ProteinMPNN, BoltzGen), antibody and nanobody design and developability, protein-ligand docking (DiffDock, Autodock Vina), binding-affinity prediction, MSA generation, and molecular dynamics. Use when the user mentions Tamarind or tamarind.bio, wants to run any of these open-source tools in the cloud, references app.tamarind.bio/api or the x-api-key header, or needs to submit batches of sequences for structural or biophysical characterization. Part of K-Dense-AI/scientific-agent-skills (AI Scientist skills) (K-Dense-AI/scientific-agent-skills).
| Upstream | K-Dense-AI/scientific-agent-skills |
| Skill file | skills/tamarind/SKILL.md |
| License | MIT |
| Author | K-Dense Inc. |
| Fetched | 2026-09-10 |
Install
npx skills add K-Dense-AI/scientific-agent-skills --skill tamarind, or copy the skill folder into~/.claude/skills/tamarind/.- Raw file:
curl -sL https://raw.githubusercontent.com/K-Dense-AI/scientific-agent-skills/HEAD/skills/tamarind/SKILL.md
SKILL.md (verbatim)
2 placeholder credentials were shortened (for example to
api_key=YOUR_KEY) to pass the site's secret filter.
name: tamarind
description: Access a collection of open-source molecular design and structural biology tools on the Tamarind Bio platform, via its REST API or MCP server — no local GPUs required. Tamarind bundles popular open-source models for structure prediction (AlphaFold, Boltz, Chai, ESMFold), protein, binder, and de novo design (RFdiffusion, ProteinMPNN, BoltzGen), antibody and nanobody design and developability, protein-ligand docking (DiffDock, Autodock Vina), binding-affinity prediction, MSA generation, and molecular dynamics. Use when the user mentions Tamarind or tamarind.bio, wants to run any of these open-source tools in the cloud, references app.tamarind.bio/api or the x-api-key header, or needs to submit batches of sequences for structural or biophysical characterization.
license: MIT
compatibility: Requires Python 3.10+, a Tamarind Bio account, and an API key from app.tamarind.bio. Uses the `requests` library against the public REST API (no dedicated Python SDK exists). Network access required. Optional MCP server at mcp.tamarind.bio/mcp for agent hosts.
metadata:
version: "1.1"
skill-author: Tamarind Bio
trigger-keywords: protein structure prediction, AlphaFold, Boltz, Chai, ESMFold, protein design, binder design, de novo design, antibody design, nanobody, protein-ligand docking, DiffDock, Autodock Vina, binding affinity, MSA generation, inverse folding, ProteinMPNN, RFdiffusion, BoltzGen, cloud GPU biology, structure prediction API, x-api-key, developability, adme, enzyme, peptide, protein language models, molecular design
openclaw:
primaryEnv: TAMARIND_API_KEY
envVars:
- name: TAMARIND_API_KEY
required: true
description: Tamarind Bio API key sent as the x-api-key header.
Tamarind Bio
Tamarind Bio is a cloud platform that runs computational biology tools — structure prediction, protein and antibody design, docking, binding-affinity, MSA generation, and molecular dynamics — on managed GPUs. Users submit sequences or structures and get back predicted structures, designs, and biophysical scores, without provisioning their own hardware. It exposes hundreds of tools (AlphaFold, Boltz-2, Chai-1, RFdiffusion, ProteinMPNN, BoltzGen, ESMFold2, DiffDock, Autodock Vina, and many more) through one uniform job API.
Official docs: app.tamarind.bio/api-docs · platform UI at app.tamarind.bio
Canonical sources — fetch these, don't rely on a stale copy
Tamarind publishes live, machine-readable sources. Prefer fetching them at runtime over trusting any hardcoded list — tool names, schemas, and endpoints change frequently:
https://app.tamarind.bio/llms.txt— LLM index: links to the spec, API docs, and MCP guide.https://app.tamarind.bio/openapi.yaml— OpenAPI 3.0 spec for the 8 core job endpoints (submit-job/-batch, jobs, result, upload, files, delete-job/-file; authApiKeyAuth). Fetch it for those exact shapes. Discovery/management endpoints (/tools,/usage-statistics, pipelines, …) aren't in it — use the MCP/REST discovery tools for those.https://docs.tamarind.bio/llms.txt— documentation index; every page has a.mdform (e.g.docs.tamarind.bio/tamarind/batch.md,/tamarind/api.md,/tamarind/pipelines.md).- Live tool discovery —
GET /tools(REST) or MCPgetAvailableTools+getJobSchema(jobType)are the source of truth for what tools exist and their parameters.
This skill teaches the surface + the non-obvious behaviors those sources don't spell out (see the reference files). When in doubt about a shape, fetch openapi.yaml.
When to use this skill
Use Tamarind when the user wants to:
- Predict structure of a protein, complex, or protein-ligand system (AlphaFold, Boltz-2, Chai-1, ESMFold2, Chai/Boltz cofolding)
- Design proteins or binders (RFdiffusion, BoltzGen, BindCraft, ProteinMPNN/LigandMPNN inverse folding)
- Design or characterize antibodies/nanobodies (sequence generation, humanization, developability, immunogenicity)
- Dock small molecules to a protein (DiffDock, Autodock Vina) or predict binding affinity
- Generate MSAs for downstream folding
- Run molecular dynamics or other biophysical workflows on managed GPUs
- Batch-screen many sequences or designs through the same tool
- Chain tools into pipelines (e.g. design → fold → score) using the output of one job as the input of the next
This skill is the right fit when the work should run on Tamarind's managed cloud rather than on a local install. For purely local cheminformatics or one-off sequence I/O, use a local library (RDKit, BioPython) instead.
Access and authentication
- Sign in at app.tamarind.bio and create an API key from the account/API settings.
- Authenticate every REST request with the
x-api-keyheader. - Never hardcode the key. Read it from the
TAMARIND_API_KEYenvironment variable or a.envfile (usepython-dotenv). Never commit keys to source control.
Pricing: Every user gets 10 free jobs. For larger usage, contact info@tamarind.bio to purchase a subscription.
export TAMARIND_API_KEY=YOUR_KEY
# List available tools
curl https://app.tamarind.bio/api/tools \
-H "x-api-key: YOUR_KEY
Base URL: https://app.tamarind.bio/api/
There is no official Python SDK — the PyPI package named tamarind is an unrelated Neo4j tool. Do not uv pip install tamarind. Write plain requests calls against the REST API (the endpoint shapes are in openapi.yaml), or use the MCP server for agent hosts.
Two ways to call Tamarind
MCP server (best for AI agents)
Tamarind hosts an MCP server at https://mcp.tamarind.bio/mcp (API-key auth via the X-API-Key header). When your agent host supports MCP, prefer it — the tools mirror the REST API with agent-friendly schemas:
listModalities()/listTags()— the live filter vocabulary (molecule type / function) with labels + tool counts; call these to learn validmodality/functionvalues instead of hardcodinggetAvailableTools(modality?, function?, search?, custom?)— discover tools (category/tagare deprecated aliases still honored)getJobSchema(jobType)— exact parameter schema for a tool, plus anexampleJobstarting payload (validate it before submitting)validateJob(jobName, type, settings)— dry-run validation before submittingsubmitJob(jobName, type, settings)/submitBatch(batchName, type, settings[], jobNames[])getJobs(jobName?, batch?, limit?, includeSequences?)— list/inspect jobs and statuses (the bulky per-job input blob is omitted by default; passincludeSequences=trueto keep it)getJobLogs(jobName)— fetch output logs for debugginglistJobFiles(jobName)— list output files (returnss3Pathfor chaining)getResult(jobName, fileName?)— download resultsuploadFile(filename)— presigned upload URL; oruploadFileContent(filename, content, encoding?)to send file content through MCP when the host can't reach S3 (sandboxed agents)
Scope note: MCP query tools (getJobs, getResult, listJobFiles, …) are scoped to the authenticated account.
REST API (universal)
Use plain HTTP with requests — the endpoint shapes are in openapi.yaml. The core loop is below; references/workflows.md has full recipes.
Core workflow
Always follow discover → schema → validate → submit → poll → results. Do not hardcode tool names or settings — the catalog changes frequently.
import os, time, requests
BASE = "https://app.tamarind.bio/api"
HEADERS = {"x-api-key": os.environ["TAMARIND_API_KEY"]}
# 1. Discover tools. REST /tools returns the full list; filter client-side.
tools = requests.get(f"{BASE}/tools", headers=HEADERS).json()
alphafold = next(t for t in tools if t["name"] == "alphafold")
# 2. Get the exact schema for the chosen tool.
# REST: each /tools entry already includes its inline `settings` schema
# (parameter list) — find the entry whose name == your job type.
# MCP: getJobSchema(jobType) returns the same per-tool detail.
# 3. Submit a job. `settings` is tool-specific — match the schema exactly.
payload = {
"jobName": "my-alphafold-run", # ^[a-zA-Z0-9_-]+$, <=100 chars, unique
"type": "alphafold",
"settings": {
"sequence": "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
"numRecycles": 3,
},
}
resp = requests.post(f"{BASE}/submit-job", headers=HEADERS, json=payload)
resp.raise_for_status() # 200 ok; 400 bad request; 403 budget exceeded; 401 unauthorized
# 4. Poll for completion.
# NOTE the response shape: GET /jobs?jobName=<name> returns the job ROW
# directly (no "jobs" wrapper); the list query (no jobName) returns
# {"jobs": [...]}. Don't index ["jobs"][0] on the by-name response.
while True:
job = requests.get(f"{BASE}/jobs", headers=HEADERS,
params={"jobName": "my-alphafold-run"}).json()
if job["JobStatus"] in ("Complete", "Stopped", "Deleted"):
break
time.sleep(30)
# 5. Retrieve results. POST /result returns a presigned URL *string*;
# GET that URL to download the actual results zip (two-step).
url = requests.post(f"{BASE}/result", headers=HEADERS,
json={"jobName": "my-alphafold-run"}).text.strip('"')
open("my-alphafold-run.zip", "wb").write(requests.get(url).content)
For the agentic version of this loop using MCP tools, and for richer examples, see references/workflows.md.
Discovering tools
The catalog has hundreds of tools. Always enumerate at runtime — never rely on a hardcoded list.
REST GET /tools returns the full list (it does not filter server-side); each item is {name, displayName, github, paper, description, settings} where settings is that tool's inline parameter schema. Filter client-side:
tools = requests.get(f"{BASE}/tools", headers=HEADERS).json() # a list
boltz = [t for t in tools if "boltz" in t["name"].lower()]
Note: both surfaces return one row per tool name — REST /tools and MCP getAvailableTools are both deduplicated (the MCP keeps the newest tool version), so a name match returns a single row.
MCP getAvailableTools(search=..., modality=..., function=...) filters server-side and adds categories/tags per tool (category/tag are deprecated aliases of modality/function, still honored). Don't hardcode the vocabulary — it drifts. Get the live values from listModalities() / listTags() (each returns value, label, description, and toolCount), or read the availableCategories / availableTags facet arrays returned on every getAvailableTools response. Modalities are molecule types (protein, antibody, peptide, small-molecule, nucleic-acid, …); functions are what a tool does (structure-prediction, binder-design, protein-ligand-docking, …).
A representative set of widely-used tools (verify with /tools): alphafold, boltz (Boltz-2), chai (Chai-1), esmfold / esmfold2, rfdiffusion, proteinmpnn, ligandmpnn, boltzgen, bindcraft, diffdock. See references/tool_catalog.md for the full category/tag map and how to read tool metadata.
Choosing the right tool
The catalog has many tools per task; don't hardcode a favorite — filter by function (and modality), then read each candidate's description and match it to the user's actual goal (input you have, output you need, constraints like speed or "no MSA"). The description and tags fields are the public "what it's for" signal; let them, plus validateJob, drive the pick. Quick orientation by task:
- Fold a single protein / complex (
function=structure-prediction): the AlphaFold3-class reproductions —boltz/chai/openfold/protenix/intfold— are the accurate default for everything, including protein-only systems; they also handle nucleic-acid + small-molecule complexes, so reach for them whenever a ligand/RNA/DNA is part of the system (andboltzadds binding-affinity).alphafold(AF2) remains a solid choice for monomers + multimers (join chains with:).esmfoldis single-sequence (no MSA) and fast — reach for it when you want speed and have no MSA;esmfold2is newer and conditions on an MSA by default (itsmodelsetting offers a faster single-sequence mode). Specialized folders exist for antibodies (abodybuilder,immunebuilder), cyclic peptides (highfold), and conformational ensembles (afcluster,alphaflow) — filter and read descriptions. - Design a binder (
function=binder-design):bindcraft(de novo miniprotein binders) andboltzgen(binders for protein and small-molecule targets, incl. nanobodies/antibodies/peptides) are the go-to de novo binder tools;rfdiffusionalso does binder design and is the pick for motif scaffolding / diversifying an existing backbone. Antibody-specific generators live underfunction=antibody-design. - Design sequence for a known backbone (
function=inverse-folding):proteinmpnn(general),ligandmpnn(ligand-aware), plus thermostable/soluble/antibody MPNN variants. Inverse folding takes a structure and emits sequences — fold them back to verify (see chaining). - Dock a small molecule (
function=protein-ligand-docking): preferboltz/chai— they co-fold the ligand into the complex and predict the bound structure rather than docking into a fixed receptor; reach forautodock-vinawhen you need fast, large-scale screening against a known pocket. - Predict binding affinity (
function=binding-affinity) or generate an MSA (searchmsa) — filter and read.
When the user names a specific tool, evaluate that one and sanity-check the alternatives in its tag group — a faster or more appropriate sibling often exists. When unsure, getJobSchema/validateJob to confirm a candidate actually accepts the input you have before committing.
Job settings, schemas, and validation
Each tool has its own settings schema. Fetch it before submitting:
- REST
/toolsentry: eachsettingsparam is a trimmed dict. Onlynameandrequiredare always present;type,default,description,optionsappear only when relevant (≈60% havetype) — so useparam.get("type"), notparam["type"]. The advanced gating keys (exclude,conditionals) are NOT in the REST response at all. - MCP
getJobSchema(jobType): the full schema, includingexclude,conditionals, and bounds. Use MCP when you need to reason about those gating keys. (restrictOrgsis stripped on both surfaces — an org-gated param you can't use is simply omitted; seereferences/api_reference.md.)
Always validateJob (MCP) before submitting — it's the reliable guard. It runs the same validation as /submit-job without submitting, and surfaces the first missing/invalid field. Don't try to hand-derive which fields to strip from the schema keys (over REST you can't see them anyway) — let validateJob tell you. (The response may include a source field, e.g. "static-fallback" — an internal note on which schema source validated; valid: true/false is the signal you act on.)
validateJob echoes a normalized view of your settings with defaults filled in. Submit the same clean settings you validated; treat normalized as informational (it can carry defaults you didn't set, and for some tools platform-managed fields), so build your submit from your own settings rather than the normalized blob.
Sequences: amino-acid string; separate chains of a multimer with a colon (:), e.g. "MVLS...:EVQL...". Note that some tools (e.g. boltz, chai) require more than sequence — boltz also requires inputFormat (and accepts yamlFile/molecules). Always getJobSchema/validateJob to learn a tool's required fields; don't assume sequence alone suffices.
Platform-internal fields — never set these yourself; the platform owns them: submit_method, monomer_msa, msa. See references/api_reference.md for the full field-handling rules.
Surface consequential choices before submitting, don't default silently. When the request fully specifies what to run, proceed. But when it's open-ended, or when a setting materially changes the results, runtime, or cost (model/variant, number of samples or seeds, MSA on/off, GPU tier, batch size), present the meaningful options plus the default you'd otherwise apply and let the user pick before you submit — rather than choosing silently and reporting it after the job is queued. getJobSchema and validateJob's normalized show exactly which knobs you're filling in on the user's behalf, so you can flag the few worth a quick confirm. This matters most for batches, where one shared-settings choice multiplies across every job.
File inputs (PDB, CIF, SDF, …)
Tools with file parameters accept input three ways:
- Upload first, then reference by bare filename.
PUT /upload/{filename}, or MCPuploadFile→ presigned URL →curl -X PUT -T file "<url>". If your host can't reach S3 (a sandboxed agent with no outbound network), use MCPuploadFileContent(filename, content, encoding?)to send the file's content through the MCP channel instead — text by default,encoding="base64"for binary. The object lands at the S3 key{email}/{filename}, but you reference it insettingsby the barefilenameonly (e.g."targetFile": "GLP1R_ECD.pdb") — the platform scopes it to your account automatically. Do NOT prefix the email: passing{email}/{filename}double-prefixes the lookup andsubmit-job400s with"The following files have not been uploaded: <email>/<file>". Confirm the exact name the store registered with MCPgetFiles(search=...)/ RESTGET /files(a flat list of bare names). - Reference a prior job's output by its path:
JobName/path/to/file.ext(this is how you chain jobs — see below). - Inline content. Send the file's text content directly as the field value.
Foot-gun: for a file-typed parameter, a plain string value is treated as inline file content, not as a path to an existing object. To point at an already-uploaded file, use the bare filename (not the {email}/... S3 key) or, for a prior job's output, the JobName/... path form — not a bare string you expect to resolve to new content.
validateJob notes. The response may carry a source field (e.g. "static-fallback") — it labels how the tool's schema was resolved (built-in tools always report static-fallback), not whether the validator was reachable, so act on valid, not source. For file params: reference an uploaded file by its bare filename (above) — a bare name resolves to your account-scoped object, whereas an email-prefixed string can be read as inline content and fail the file-type check ("... must contain ATOM records"). And passing inline file content makes validateJob upload it synchronously before validating, which can be slow; prefer referencing an uploaded file by name (above). If a dry-run is slow, skip it and let submit-job validate.
Chaining jobs into pipelines
A finished job's output becomes the next job's input — no download/re-upload. Match the input type the next tool actually wants: a sequence-design tool (ProteinMPNN) emits sequences, so you fold them by passing each as a sequence; a tool that takes a file parameter takes a path.
The cleanest design→fold chain is the MCP submitBatch(fromJob=...), which reads a completed design job's generated sequences and folds each as one job:
# ProteinMPNN designs sequences -> fold every one with AlphaFold, one call:
submitBatch(batchName="verify-designs", type="alphafold", fromJob="my-proteinmpnn-job")
For a file input (e.g. a tool that takes a .pdb/.cif), reference a prior job's output by the path form JobName/path/to/file.ext in that file parameter. Two cautions, both confirmed by validation: (1) match the parameter's required file type — e.g. AlphaFold's templateFiles accepts only .cif and is a list, and is gated behind templateMode: "custom"; (2) templateFiles is for structural templates, not for "fold this designed sequence" — to fold a sequence, pass sequence. Always getJobSchema/validateJob to confirm a file param's type/conditions before chaining into it.
To discover a job's exact output paths, use MCP listJobFiles(job1) — it returns each file's s3Path, usable directly in the next submitJob. (The REST GET /files lists your account's uploaded files as a flat name list; it does not enumerate a job's outputs.) Tamarind also supports saved pipelines: build one in the UI, then drive it with /run-pipeline ({pipelineName, initialInputs, inputs}) or define stages[] inline via /submit-pipeline (each stage names a task + toolSettings, using "pdbFile": "pipe" to thread one stage's output into the next). See references/workflows.md.
Batch submission
Submit many jobs of the same tool in one call. The Python form uses parallel settings[] and jobNames[] arrays (same length, up to 100):
requests.post(f"{BASE}/submit-batch", headers=HEADERS, json={
"batchName": "egfr-binder-screen",
"type": "alphafold",
"jobNames": ["seq1", "seq2", "seq3"],
"settings": [{"sequence": "..."}, {"sequence": "..."}, {"sequence": "..."}],
# optional: "maxRuntimeSeconds": 3600, "weightedHoursBudget": 100,
# (some accounts also accept an optional "gpuType" — confirm with support)
})
Poll the batch parent on batchStatus, not subjob JobStatus. A batch creates a parent job (Type: "batch") plus subjobs. Subjobs flip to Complete as soon as they finish computing, but the batch then spends a few minutes aggregating results into the final downloadable output. Fetch the parent by name and watch batchStatus:
import time
while True:
# ?jobName= returns the parent ROW directly (no "jobs" wrapper)
parent = requests.get(f"{BASE}/jobs", headers=HEADERS,
params={"jobName": "egfr-binder-screen"}).json()
bs = parent.get("batchStatus")
if bs == "Complete":
break
if bs in ("Stopped", "AggregationFailed"):
raise RuntimeError(parent.get("AggregationError", bs))
time.sleep(15) # Running / Aggregating -> keep waiting
# When Complete, the parent carries a presigned `resultUrl` and a `statuses`
# subjob tally ({Complete, Running, In Queue, Stopped}).
open("batch.zip", "wb").write(requests.get(parent["resultUrl"]).content)
Add includeSubjobs=true to GET /jobs?batch=<name> to list per-subjob rows.
Job status lifecycle
Single jobs report JobStatus; batch parents report batchStatus (poll that for batches — see above).
| Status | Meaning |
|---|---|
In Queue |
Accepted, waiting for capacity |
Running |
Executing on a worker |
Complete |
Finished successfully — results available |
Stopped |
Stopped (failure, timeout, manual stop, or budget) |
Deleted |
Job was deleted out-of-band |
Aggregating |
(batch parent only) subjobs done; building the final output |
AggregationFailed |
(batch parent only) aggregation step failed |
Completed jobs carry a Score (tool-specific metrics, e.g. pLDDT/pTM/ipTM for folding) and WeightedHours. Treat Complete/Stopped/Deleted (and AggregationFailed for batches) as terminal; poll on a 15-30s interval. Break your poll loop on any terminal status, not just Complete/Stopped — a job that goes Deleted mid-poll would otherwise loop forever. For a Stopped job, fetch getJobLogs(jobName) to see why. WeightedHours is the usage unit billed per job; cap a batch with weightedHoursBudget, and a 403 on submit means a budget was hit (see references/api_reference.md and the /usage-statistics endpoint).
Error handling
| Code | Meaning | Action |
|---|---|---|
| 400 | Bad request / invalid settings | Re-check against the schema; run validateJob first |
| 401 | Unauthorized | Check x-api-key |
| 403 | Budget exceeded (org/team) | Lower scope or raise the budget |
| 429 | Rate limited | Back off and retry |
| 500 | Server error | Retry; if persistent, contact support |
Reference files
The openapi.yaml spec is the source of truth for endpoint shapes; these files add the behaviors and gotchas the spec doesn't spell out:
references/examples.md— validatedsettingspayloads per common tool (alphafold/boltz/diffdock/autodock-vina/proteinmpnn/batch), a copy-paste self-check, the "what fails and the exact error" list, and output-shape notes. Start here for a working payload.references/api_reference.md— endpoint quick-reference + the non-obvious shapes:/jobsby-name returns a bare row (not{jobs:[...]}),/resultis a two-step download, batch parents poll onbatchStatus,/filesis a flat name list, thesettingsfield-handling rules.references/tool_catalog.md— category/tag map, how to read tool + parameter metadata, common tool families.references/workflows.md— end-to-end recipes: fold a sequence, validate-before-submit, upload + reference a file, design→fold chaining, batch screen with aggregation polling, usage stats, pagination, and the non-blocking submit-now/check-later pattern for long jobs.
Other files in this skill
- references/api_reference.md
- references/examples.md
- references/tool_catalog.md
- references/workflows.md
references/api_reference.md (verbatim)
Tamarind Bio REST API reference
Spec: the OpenAPI spec at https://app.tamarind.bio/openapi.yaml (3.0, auth ApiKeyAuth) covers the 8 core job endpoints (/submit-job, /submit-batch, /jobs, /result, /upload/{filename}, /files, /delete-job, /delete-file) — fetch it for those exact shapes. It does not include the discovery/management endpoints (/tools, /usage-statistics, /submit-pipeline, /run-pipeline, /stop-job) — for those, use this file + the live MCP getAvailableTools/getJobSchema/getJobs. This file also adds the behaviors no spec spells out (response-shape-by-query, two-step result download, batch aggregation polling, REST-vs-MCP field differences).
Base URL: https://app.tamarind.bio/api/
Authentication: x-api-key: <YOUR_KEY> header on every request.
Interactive docs: app.tamarind.bio/api-docs · markdown docs at docs.tamarind.bio
There is no official Python SDK. Call the API with requests (Python) or curl. An MCP server (https://mcp.tamarind.bio/mcp, X-API-Key header) exposes the same operations with agent-friendly schemas.
Endpoints
| Method | Path | Purpose |
|---|---|---|
| GET | /tools |
List available tools and their inline parameter schemas. Returns the full list (no server-side filtering — filter client-side). |
| POST | /submit-job |
Submit one job. Body: jobName, type, settings (+ optional projectTag). |
| POST | /submit-batch |
Submit many jobs of the same tool. See payload shapes below. |
| GET | /jobs |
List/inspect jobs. Query: jobName, batch, limit, startKey, organization, includeSubjobs, jobEmail. |
| POST | /result |
Get a presigned download URL for job results (two-step — see below). Body: jobName (+ optional fileName, pdbsOnly, jobEmail). |
| POST | /stop-job |
Stop a running or queued job. Body: jobName. |
| DELETE | /delete-job |
Delete a job and its data. Body: jobName. |
| PUT | /upload/{filename} |
Upload a file (--data-binary; add ?folder= to file it). Or get a presigned URL via MCP uploadFile. |
| GET | /files |
List your account's uploaded files as a flat array of filename strings. Query: folder, includeFolders=true. Does not enumerate a specific job's outputs — use MCP listJobFiles for that. |
| DELETE | /delete-file |
Remove a file/folder. Query: filePath or folder. |
| POST | /submit-pipeline |
Run a multi-step pipeline defined inline via stages[]. |
| POST | /run-pipeline |
Run a pipeline saved in the UI. Body: pipelineName, initialInputs/inputs. |
| GET | /usage-statistics |
Usage/billing. Query: statistic (weighted_hours/jobs), scope (user/org). |
Request shapes
GET /tools
Returns a JSON array. Each element:
{
"name": "alphafold",
"displayName": "AlphaFold",
"description": "Accurate and quick protein structure prediction ...",
"github": "https://github.com/...",
"paper": "https://...",
"settings": [ { "name": "sequence", "type": "sequence", "required": true, "description": "..." }, ... ]
}
In each settings param, only name and required are guaranteed; type, default, description, options are present only when applicable (about 60% of params carry type). Read them with param.get("type"), not param["type"].
settings is the tool's inline parameter schema — read it directly, no separate schema endpoint over REST. The REST list is not filtered by query params; filter client-side on name/displayName/description. (The MCP getAvailableTools wraps the list as {"totalTools", "tools":[...]} and adds categories/tags per tool plus server-side search/category/tag filtering.)
POST /submit-job
{
"jobName": "my-protein-analysis",
"type": "alphafold",
"settings": { "sequence": "MKT...", "numRecycles": 3 },
"projectTag": "proj_xxxxxxxx"
}
jobName— unique,^[a-zA-Z0-9_-]+$, 1-100 chars.type— a tool name from/tools. The list changes often; never hardcode.settings— tool-specific; match the schema from/tools(or MCPgetJobSchema).projectTag— optionalproj_...ProjectId to file the job under a project.
Response (200): a confirmation string like myJobName submitted to queue.
POST /submit-batch
Two payload shapes appear in the official docs — the Python form uses parallel arrays; the curl form uses a jobs[] array of objects with a tool key. The parallel-array form matches the MCP submitBatch and is the recommended one:
{
"batchName": "egfr-screen",
"type": "alphafold",
"jobNames": ["seq1", "seq2"],
"settings": [{ "sequence": "..." }, { "sequence": "..." }],
"maxRuntimeSeconds": 3600,
"weightedHoursBudget": 100
}
curl-form alternative (same endpoint): { "tool": "<type>", "batchName": ..., "jobs": [{ "jobName": ..., "settings": {...} }, ...] }.
jobNamesandsettingsare parallel arrays, same length, 1-100 items, all using the same tool.maxRuntimeSeconds— optional per-job timeout.weightedHoursBudget— optional budget cap.- The MCP
submitBatchschema exposesmaxRuntimeSeconds+weightedHoursBudget. Some accounts/tools may accept an optionalgpuType(seen in the docs UI), but it isn't inopenapi.yamlor the MCP schema — treat it as unverified and confirm with support before relying on it.
GET /jobs
Response shape depends on the query:
- List / batch query (no
jobName, or?batch=/?organization=) →{ "jobs": [...], "startKey": "...", "statuses": {...} }. - By-name (
?jobName=<name>) → the job row object directly (nojobswrapper). Don't index["jobs"][0]on this response.
Each job row includes JobName, Type, JobStatus, Created, Started, Completed, Settings (JSON string), Score (JSON string, tool metrics), WeightedHours. Use startKey for pagination past the limit (default 1000). Only top-level jobs return by default; add includeSubjobs=true for batch subjobs.
Batch parent rows have Type: "batch" and carry batchStatus. Fetched by name (?jobName=<batchName>), a complete batch parent also includes resultUrl (presigned download). batchStatus transitions: Running → Aggregating → Complete (or AggregationFailed, with AggregationError). Poll the parent's batchStatus, not subjob JobStatus — subjobs go Complete before the aggregated output is ready.
Discriminate batch vs single by Type == "batch" (or presence of batchStatus), not by statuses. A by-name response can carry a statuses tally even for a single (non-batch) job, so statuses presence is not a reliable batch signal.
POST /result (two-step download)
POST returns a presigned URL as a bare string (not JSON). Fetch that URL with a second GET to download the results zip:
url = requests.post(f"{BASE}/result", headers=H, json={"jobName": "myJob"}).text.strip('"')
open("myJob.zip", "wb").write(requests.get(url).content)
Optional body fields: fileName (one file instead of the zip), pdbsOnly: true (PDB outputs only), jobEmail (a teammate's job, if permitted).
Status codes
| Code | Meaning |
|---|---|
| 200 | Success |
| 400 | Bad request — invalid parameters/settings |
| 401 | Unauthorized — invalid/missing x-api-key |
| 403 | Budget exceeded (org/team) |
| 429 | Rate limited |
| 404 | Not found (e.g. unknown job) |
| 500 | Server error |
Field-handling rules (important)
The REST and MCP schemas expose different fields. The REST /tools entry
gives a trimmed per-param view — {name, type, required, default, description, options}.
The advanced gating keys exclude and conditionals appear only in MCP
getJobSchema, not in REST /tools (restrictOrgs is no longer returned by
either surface — see below). So don't try to hand-derive what to strip from REST
schema keys — they aren't there. The reliable guard on
both surfaces is validateJob (MCP): it runs /submit-job's exact validation
without submitting and returns the first error.
- Build your submit from your own settings, not
validateJob'snormalizedoutput.normalizedis informational (defaults filled in, sometimes platform-managed fields). Submit the same clean settings you validated, not the normalized echo. - Platform-internal routing fields —
submit_method,monomer_msa,msaare set by the platform. Never pass them. restrictOrgs— org-gated parameters.getJobSchemano longer returns this key (it's stripped server-side): a parameter your account isn't authorized for is dropped from the schema entirely, and any param you do see is one you may set. So you won't encounterrestrictOrgsin a response — don't look for it.conditionals(MCP schema only) — a field only applies when another field has a given value (e.g.pairModeapplies only whenuseMSAistrue). Don't send conditioned fields when their condition isn't met.exclude: [...](MCP schema only) — marks a field as UI/pipeline-only for a surface. Treat it as advisory;validateJobis the authority on what a given submission accepts.required: true— must be present. Some tools require more thansequence(e.g.boltzrequiresinputFormat). RunvalidateJobto get the first missing/invalid field before submitting.- File-typed fields with a plain string value are treated as INLINE CONTENT,
not a path. To reference an uploaded file, use its bare filename
(
target.pdb) — the platform scopes it to your account, so do NOT email-prefix it. The{email}/{filename}form is the underlying S3 key, and passing it makessubmit-job400 with"The following files have not been uploaded: <email>/<file>". To reference a prior job's output, useJobName/path/to/file.ext. Confirm the exact registered name withgetFiles/GET /files(a flat list of bare names).
Authentication and secrets
- Read the key from
TAMARIND_API_KEY(env or.env); never hardcode or commit it. - The same key authenticates REST (
x-api-key) and the MCP server (X-API-Key). - Query operations are scoped to the authenticated account (and, with
organization=true/jobEmail, to your org if permitted).
references/examples.md (verbatim)
Tamarind Bio — validated examples & output shapes
The freshest example for any tool is the exampleJob field MCP getJobSchema(<tool>)
now returns — an {jobName, type, settings} built from each param's example/default
(with an exampleJobNote; org-gated params you can't use are omitted, file params get
placeholder filenames). It's the best starting point, but run validateJob on it
before submitting — it's assembled from per-param examples, not a guaranteed-valid
payload, so a given tool's exampleJob can need a tweak. The payloads below are a
validateJob-confirmed fallback for REST callers or when you want a worked example.
Tool schemas evolve — if one stops validating, re-fetch with getJobSchema(<tool>) /
GET /tools. Sequences here are illustrative; swap your own.
File params (proteinFile, pdbFile, ligandFile, …) need a real file value —
either the bare filename of an uploaded file (target.pdb — NOT email-prefixed),
a prior-job output path (JobName/out/x.pdb), or
inline PDB/SDF-format text (multi-line ATOM/HETATM records). The
<...> placeholders below are NOT valid as written — replace them. Do not put an
amino-acid sequence in a file param — validateJob rejects it with
File ... must be of types: ["pdb"]. (A sequence goes in sequence, a structure
goes in a file param.)
BASE = "https://app.tamarind.bio/api", HEADERS = {"x-api-key": <key>}.
Self-check (run this first to confirm the skill works for you)
Read-only + dry-run, no submission, no cost. Confirms the discover → schema → validate loop end-to-end:
import os, requests
BASE, HEADERS = "https://app.tamarind.bio/api", {"x-api-key": os.environ["TAMARIND_API_KEY"]}
# 1. discovery reachable?
tools = requests.get(f"{BASE}/tools", headers=HEADERS).json()
assert isinstance(tools, list) and any(t["name"] == "alphafold" for t in tools), "tools endpoint"
# 2. validate a known-good payload (MCP validateJob; or skip if REST-only)
# expect {"valid": true, ...}
With the MCP server: validateJob(jobName="selfcheck", type="alphafold", settings={"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIE"}) → valid: true.
Validated input payloads
AlphaFold — monomer
{ "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKR",
"numModels": "1", "numRecycles": 3 }
Only sequence is required; everything else has a default. numModels is a string
dropdown ("1"–"5").
AlphaFold — multimer (colon-separated chains)
{ "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIE:DIQMTQSPSSLSASVGDRVTITCRASQSISSYLN" }
Join chains with :. No separate "multimer" flag — chain count drives it.
Boltz-2 — sequence mode
{ "inputFormat": "sequence",
"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALP" }
inputFormat is required ("sequence" / "list" / "molecules" / "yaml").
Omitting it fails — see "What fails" below.
DiffDock — protein + SMILES ligand
{ "ligandFormat": "SMILES",
"ligandSmiles": "CC(=O)Oc1ccccc1C(=O)O",
"proteinFile": "<uploaded-path-or-inline-PDB-text>" }
ligandFormat chooses the conditional field: "SMILES" → ligandSmiles;
"sdf/mol2 file" → ligandFile. proteinFile is a file param — pass an uploaded
file's bare filename (target.pdb, not email-prefixed), a prior-job path
(JobName/...), or inline PDB text (see file-input rules in api_reference.md).
Autodock Vina — protein + SMILES ligand (classical docking into a pocket)
{ "receptorFile": "receptor.pdb",
"ligandFormat": "smiles",
"ligandSmiles": "CC(=O)Oc1ccccc1C(=O)O",
"boxX": 15.19, "boxY": 53.903, "boxZ": 16.917,
"width": 20, "height": 20, "depth": 20 }
Unlike DiffDock, Autodock Vina docks into a fixed pocket, so it requires a bounding
box (boxX/Y/Z center + width/height/depth, all required) and the receptor in
receptorFile (not proteinFile). Its ligandFormat enum is lowercase
("smiles" / "sdf") — different from DiffDock's "SMILES" / "sdf/mol2 file", so
don't copy DiffDock's value across. exhaustiveness (default 8) is optional. validateJob-confirmed.
ProteinMPNN — design residues on a backbone
{ "pdbFile": "<uploaded-path-or-inline-PDB-text>",
"designedResidues": { "A": "1 2 3 4 5" },
"numSequences": 4, "modelType": "proteinmpnn" }
Requires pdbFile + designedResidues (per-chain, space-separated resnums).
modelType ∈ proteinmpnn/ligandmpnn/solublempnn/hypermpnn/abmpnn.
Note designedChains is exclude:["api"] — don't send it over the API.
Batch (same tool, many jobs)
{ "batchName": "screen-1", "type": "alphafold",
"jobNames": ["s1", "s2"],
"settings": [ { "sequence": "MKT..." }, { "sequence": "AVF..." } ] }
What fails (and the exact error) — confirmed live
- Boltz without
inputFormat→valid:false,Missing required boltz field "inputFormat". Always check required fields withgetJobSchemafirst;sequencealone is not enough for boltz/chai. - Building a submit from
validateJob'snormalizedblob —normalizedis informational (defaults filled in, sometimes platform-managed fields). Submit the cleansettingsyou validated, not the normalized echo. - File param given a bare string that isn't a real path → treated as INLINE file content (uploaded as
<email>/<jobname>-<param>.<ext>), not a reference. To point at an existing uploaded file use its bare filename (target.pdb— do NOT email-prefix it;{email}/{filename}is the S3 key and 400s as not-uploaded), orJobName/...for a prior job's output. Referencing a path that doesn't exist →File ... has not been uploaded.
Output shapes (describe, don't expect exact values)
Outputs are non-deterministic (seed/model/MSA) — reason about the shape, not golden numbers.
- Job row
Score(JSON string on completed jobs): tool-family dependent.- Folding (alphafold/boltz/chai/esmfold):
plddt,ptm, and for complexesiptmplus interface metrics (ipSAE_*,pDockQ_*). Higher pLDDT/pTM = more confident; iptm/ipSAE gauge interface quality. - Other families carry their own metrics — read the keys, don't assume.
- Folding (alphafold/boltz/chai/esmfold):
- Results zip (
POST /result→ presigned URL → GET): per-tool, typically the structure files (rank_*.pdb/*.cif), a scores CSV, and logs. UselistJobFiles(jobName)(MCP) to enumerate exact filenames before downloading. WeightedHourson the row is the billing unit (seeusage-statistics).
To learn a specific tool's exact outputs, run one small job and listJobFiles it —
don't hardcode filenames, which vary by tool and version.
references/tool_catalog.md (verbatim)
Tamarind Bio tool catalog
Tamarind exposes hundreds of tools through one uniform job API. The catalog changes frequently — always enumerate at runtime with GET /tools (or MCP getAvailableTools) rather than hardcoding names. This file is a map for interpreting what you get back.
How to discover
REST GET /tools returns the full list (it does not filter server-side). Filter client-side:
tools = requests.get(f"{BASE}/tools", headers=HEADERS).json() # a list
docking = [t for t in tools if "vina" in t["name"].lower()]
Each REST tool entry carries: name (the type you submit), displayName, description, github, paper, and settings (the inline parameter schema). REST entries do not include categories/tags.
MCP getAvailableTools(search=..., modality=..., function=...) filters server-side and returns entries with categories and tags (category/tag are deprecated aliases of modality/function, still honored).
Modalities and functions (the two filter axes)
Don't hardcode the filter vocabulary — it drifts as tools are added. Fetch it live: listModalities() returns the molecule-type axis (protein, antibody, enzyme, peptide, nucleic-acid, small-molecule, small-molecule-binding-protein, cryoem, …); listTags() returns the function axis (structure-prediction, protein-design, binder-design, protein-ligand-docking, binding-affinity, inverse-folding, developability, molecular-dynamics, finetuning, …). Each entry carries value, label, description, and a live toolCount. Every getAvailableTools response also includes availableCategories / availableTags arrays computed from the current catalog. Filter with getAvailableTools(modality=..., function=...).
Representative tool families
Verify exact names and availability with /tools — these are common anchors, not an exhaustive or guaranteed list.
Structure prediction / folding
alphafold— AlphaFold; monomer + multimer, MSA + templates, recycles, relaxation.boltz— Boltz-2; structure + affinity, biomolecular complexes incl. ligands.chai— Chai-1; complex structure prediction with optional MSA.esmfold/esmfold2— fast single-sequence folding.
Protein / binder design
rfdiffusion— protein/binder design and motif scaffolding.boltzgen— generative design.bindcraft— binder design.proteinmpnn/ligandmpnn— inverse folding (sequence given backbone; ligand-aware variant).
Docking / affinity
boltz/chai— co-fold the ligand into the complex (predict the bound structure); the default for protein-small-molecule docking.autodock-vina— classical docking into a known pocket; the pick for fast, large-scale screening.- Boltz/affinity tools — binding-affinity prediction.
Antibody
- Antibody language models and generators, humanization, developability, immunogenicity scoring.
MSA / utilities
- MSA generation tools feed downstream folding; utilities cover format conversion, scoring, and analysis.
Reading a tool schema
getJobSchema(jobType) (MCP) or the /tools entry returns a parameters list. Each parameter has:
name,type(sequence,number,boolean,dropdown, file types likepdb/cif/sdf, …)descr,displayNamerequired,defaultoptions/optionsDescr(for dropdowns),lowerBound/upperBound/lengthLimitconditionals— applies only when another field has a given valueexclude(["api"]/["batch"]) — omit on that surfacelist: true— accepts multiple values/filesexample— a sample value
(Org-gated parameters are filtered server-side: getJobSchema drops a param your account isn't authorized for and never returns the old restrictOrgs key.)
Top-level tool metadata also includes a hint, and getJobSchema returns an exampleJob built from each parameter's example/default — start from that (then validateJob it) rather than hand-building settings.
Always read the schema before constructing settings, and run validateJob to confirm before submitJob.
Back to K-Dense-AI/scientific-agent-skills (AI Scientist skills) or Agent skills.